PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G67300.1
Common NameATMYB44, ATMYBR1, K8K14.2, MYB44, MYBR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 305aa    MW: 33268.2 Da    PI: 8.1123
Description myb domain protein r1
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G67300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.5e-19651147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde+l ++v ++G+++W+ I++ ++ gR++k+c++rw + 
      AT5G67300.1  6 KGPWSPEEDEQLRRLVVKYGPRNWTVISKSIP-GRSGKSCRLRWCNQ 51
                     79******************************.***********985 PP

2Myb_DNA-binding56.46.7e-1860102347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +++a++q+G++ W+tIar ++ gRt++ +k++w++ 
      AT5G67300.1  60 PFSAEEDETIARAHAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.606156IPR017930Myb domain
SuperFamilySSF466893.0E-31399IPR009057Homeodomain-like
SMARTSM007171.6E-17554IPR001005SANT/Myb domain
PfamPF002498.8E-19651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-25758IPR009057Homeodomain-like
CDDcd001677.72E-17850No hitNo description
SMARTSM007171.3E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129419.7758107IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2259106IPR009057Homeodomain-like
CDDcd001678.77E-1260103No hitNo description
PfamPF002497.0E-1560102IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000034anatomyvascular system
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MADRIKGPWS PEEDEQLRRL VVKYGPRNWT VISKSIPGRS GKSCRLRWCN QLSPQVEHRP  60
FSAEEDETIA RAHAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCGGY DHRGYDGSED  120
HRPVKRSVSA GSPPVVTGLY MSPGSPTGSD VSDSSTIPIL PSVELFKPVP RPGAVVLPLP  180
IETSSSSDDP PTSLSLSLPG ADVSEESNRS HESTNINNTT SSRHNHNNTV SFMPFSGGFR  240
GAIEEMGKSF PGNGGEFMAV VQEMIKAEVR SYMTEMQRNN GGGFVGGFID NGMIPMSQIG  300
VGRIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-3951073105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-38510657158MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-38510657158MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-3951073105C-Myb DNA-Binding Domain
1msf_C2e-3951073105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.288160.0bud| flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453597760.0
Genevisible246987_at0.0
Expression AtlasAT5G67300-
AtGenExpressAT5G67300-
ATTED-IIAT5G67300-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor MYB gene family involved in mediating plant responses to a variety of abiotic stimiuli.
UniProtTranscription factor. Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}.
Function -- GeneRIF ? help Back to Top
  1. Enhanced abiotic stress tolerance of transgenic Arabidopsis overexpressing AtMYB44 was conferred by reduced expression of genes encoding a group of serine/threonine protein phosphatases 2C.
    [PMID: 18162593]
  2. AtMYB44 gene activation appears to not be induced by any specific hormone
    [PMID: 20016937]
  3. AtMYB44 regulates induced expression of EIN2 in HrpN(Ea)-treated Arabidopsis plants. AtMYB44 protein localizes to nuclei and binds the EIN2 promoter; HrpN(Ea) treatment promotes AtMYB44 production, binding activity, and transcription of AtMYB44 and EIN2.
    [PMID: 21117868]
  4. HrpN Ea-induced deterrent effect on phloem feeding of the green peach aphid Myzus persicae requires AtGSL5 and AtMYB44 genes in Arabidopsis thaliana.
    [PMID: 21451254]
  5. the transcriptional regulator MYB44 has a role in the control of seed germination in Arabidopsis thaliana.
    [PMID: 22704933]
  6. AtMYB44 modulates antagonistic interaction by activating SA-mediated defenses and repressing JA-mediated defenses through direct control of WRKY70
    [PMID: 23067202]
  7. the C-terminal side of the protein, but not the N-terminal side of the R2R3 domain, contributes to the functional activity and specificity of AtMYB44 through interactions with other regulators generated by each of a variety of stimuli.
    [PMID: 23161171]
  8. MYB44 is regulated by MPK3 via phosphorylation whereby initiating the adaptation response to numerous abiotic and biotic stresses.
    [PMID: 23437396]
  9. AtMYB44 is an integrator of cross-talk between salicylic acid and jasmonic acid in plant defense responses.
    [PMID: 23603962]
  10. Dominant repression by Arabidopsis transcription factor MYB44 causes oxidative damage and hypersensitivity to abiotic stress.
    [PMID: 24531138]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00596DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G67300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G26790 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G17550(R), AT1G72770(R), AT3G11410(R), AT4G26080(R), AT5G03280(A), AT5G44420(R), AT5G57050(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, ethylene, gibberellin, jasmonic acid, Jasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G67300
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G67300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0076450.0AB007645.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8K14.
GenBankAF3268770.0AF326877.1 Arabidopsis thaliana putative myb-related protein, 33.3K (At5g67300) mRNA, complete cds.
GenBankAF3396980.0AF339698.1 Arabidopsis thaliana putative myb-related protein, 33.3K (At5g67300) mRNA, complete cds.
GenBankAY5196480.0AY519648.1 Arabidopsis thaliana MYB transcription factor (At5g67300) mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201531.10.0transcription factor MYB44
SwissprotQ9FDW10.0MYB44_ARATH; Transcription factor MYB44
TrEMBLD7MKR10.0D7MKR1_ARALL; AtMYB44/AtMYBr1
STRINGAT5G67300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Kersten B, et al.
    Generation of Arabidopsis protein chips for antibody and serum screening.
    Plant Mol. Biol., 2003. 52(5): p. 999-1010
    [PMID:14558660]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  6. Ko JH,Han KH,Park S,Yang J
    Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling.
    Plant Physiol., 2004. 135(2): p. 1069-83
    [PMID:15194820]
  7. Reymond P, et al.
    A conserved transcript pattern in response to a specialist and a generalist herbivore.
    Plant Cell, 2004. 16(11): p. 3132-47
    [PMID:15494554]
  8. Devoto A, et al.
    Expression profiling reveals COI1 to be a key regulator of genes involved in wound- and methyl jasmonate-induced secondary metabolism, defence, and hormone interactions.
    Plant Mol. Biol., 2005. 58(4): p. 497-513
    [PMID:16021335]
  9. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  10. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  11. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  12. Shin R, et al.
    The Arabidopsis transcription factor MYB77 modulates auxin signal transduction.
    Plant Cell, 2007. 19(8): p. 2440-53
    [PMID:17675404]
  13. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  14. Wang Z, et al.
    Identification and characterization of COI1-dependent transcription factor genes involved in JA-mediated response to wounding in Arabidopsis plants.
    Plant Cell Rep., 2008. 27(1): p. 125-35
    [PMID:17786451]
  15. Jung C, et al.
    Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis.
    Plant Physiol., 2008. 146(2): p. 623-35
    [PMID:18162593]
  16. Sreenivasulu N, et al.
    Barley grain maturation and germination: metabolic pathway and regulatory network commonalities and differences highlighted by new MapMan/PageMan profiling tools.
    Plant Physiol., 2008. 146(4): p. 1738-58
    [PMID:18281415]
  17. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  18. Pitzschke A,Djamei A,Teige M,Hirt H
    VIP1 response elements mediate mitogen-activated protein kinase 3-induced stress gene expression.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(43): p. 18414-9
    [PMID:19820165]
  19. Jung C, et al.
    Non-specific phytohormonal induction of AtMYB44 and suppression of jasmonate-responsive gene activation in Arabidopsis thaliana.
    Mol. Cells, 2010. 29(1): p. 71-6
    [PMID:20016937]
  20. Liu R, et al.
    Thirty-seven transcription factor genes differentially respond to a harpin protein and affect resistance to the green peach aphid in Arabidopsis.
    J. Biosci., 2010. 35(3): p. 435-50
    [PMID:20826953]
  21. Liu R, et al.
    Transcription factor AtMYB44 regulates induced expression of the ETHYLENE INSENSITIVE2 gene in Arabidopsis responding to a harpin protein.
    Mol. Plant Microbe Interact., 2011. 24(3): p. 377-89
    [PMID:21117868]
  22. L
    HrpN Ea-induced deterrent effect on phloem feeding of the green peach aphid Myzus persicae requires AtGSL5 and AtMYB44 genes in Arabidopsis thaliana.
    J. Biosci., 2011. 36(1): p. 123-37
    [PMID:21451254]
  23. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  24. Nguyen XC, et al.
    Phosphorylation of the transcriptional regulator MYB44 by mitogen activated protein kinase regulates Arabidopsis seed germination.
    Biochem. Biophys. Res. Commun., 2012. 423(4): p. 703-8
    [PMID:22704933]
  25. Shim JS, et al.
    AtMYB44 regulates WRKY70 expression and modulates antagonistic interaction between salicylic acid and jasmonic acid signaling.
    Plant J., 2013. 73(3): p. 483-95
    [PMID:23067202]
  26. Jung C, et al.
    Quadruple 9-mer-based protein binding microarray analysis confirms AACnG as the consensus nucleotide sequence sufficient for the specific binding of AtMYB44.
    Mol. Cells, 2012. 34(6): p. 531-7
    [PMID:23161171]
  27. Persak H,Pitzschke A
    Tight interconnection and multi-level control of Arabidopsis MYB44 in MAPK cascade signalling.
    PLoS ONE, 2013. 8(2): p. e57547
    [PMID:23437396]
  28. Shim JS,Choi YD
    Direct regulation of WRKY70 by AtMYB44 in plant defense responses.
    Plant Signal Behav, 2013. 8(6): p. e20783
    [PMID:23603962]
  29. L
    AtMYB44 regulates resistance to the green peach aphid and diamondback moth by activating EIN2-affected defences in Arabidopsis.
    Plant Biol (Stuttg), 2013. 15(5): p. 841-50
    [PMID:23656500]
  30. Persak H,Pitzschke A
    Dominant repression by Arabidopsis transcription factor MYB44 causes oxidative damage and hypersensitivity to abiotic stress.
    Int J Mol Sci, 2014. 15(2): p. 2517-37
    [PMID:24531138]
  31. Zhao Y, et al.
    The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes.
    Sci Signal, 2014. 7(328): p. ra53
    [PMID:24894996]
  32. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  33. Kirik V,K
    Two novel MYB homologues with changed expression in late embryogenesis-defective Arabidopsis mutants.
    Plant Mol. Biol., 1998. 37(5): p. 819-27
    [PMID:9678577]